PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598249.1
Common Name40.t00054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 343aa    MW: 38508.3 Da    PI: 5.0924
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598249.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-131562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd +lv ++ + G g W++ ++  g++R++k+c++rw +yl
   XP_013598249.1 15 KGPWMPEEDYKLVAYIDKNGYGKWRSLPNIAGLNRCGKSCRLRWMNYL 62
                     79********************************************97 PP

2Myb_DNA-binding57.82.5e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T+eE+   v+++++lG++ W++Ia++++ gRt++++k++w++++
   XP_013598249.1  68 RGEFTEEEESTVVKLHALLGNK-WSKIASHLP-GRTDNEIKNYWNTHM 113
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5491062IPR017930Myb domain
SuperFamilySSF466891.91E-2912109IPR009057Homeodomain-like
SMARTSM007171.1E-81464IPR001005SANT/Myb domain
PfamPF002494.2E-121562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-211669IPR009057Homeodomain-like
CDDcd001672.13E-71762No hitNo description
PROSITE profilePS5129427.40263117IPR017930Myb domain
SMARTSM007174.0E-1767115IPR001005SANT/Myb domain
PfamPF002491.5E-1668112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2770117IPR009057Homeodomain-like
CDDcd001672.99E-1370113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSPCCDQD KGVKKGPWMP EEDYKLVAYI DKNGYGKWRS LPNIAGLNRC GKSCRLRWMN  60
YLRPDIRRGE FTEEEESTVV KLHALLGNKW SKIASHLPGR TDNEIKNYWN THMRKKMLQM  120
GIDPITHEPK TNDLSPILDV SQMLAAAIGN GQFGNNTLFN NNIAVEDLLK LQLIHKMLQI  180
ITPKAMPNTN SFNTNSLDTK PVANNIKTNP VNPKPEQAAG QLNAIDPHVF TSQIENEDFM  240
PSFEDAWDCF GDNQLPGLVM VSQENLNYQT GAGMMPDYYG DQLREVPSTG SISVTPETSG  300
LNYPGTTQHS SGSNVQEDWE KFLDDETSDS CWKSFLDLTS PTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-27151174105C-Myb DNA-Binding Domain
1msf_C2e-27151174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1834920.0AC183492.1 Brassica oleracea Contig G, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598249.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_013646946.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP00.0MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D3DEP50.0A0A0D3DEP5_BRAOL; Uncharacterized protein
TrEMBLQ2A9680.0Q2A968_BRAOL; Myb family transcription factor
STRINGBra012641.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122431730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17785.10.0myb domain protein 39